General Information

  • ID:  hor004297
  • Uniprot ID:  A0A8C2TH99
  • Protein name:  Neuropeptide K
  • Gene name:  TAC1
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Tachykinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DAGYGQISH
  • Length:  9
  • Propeptide:  MGWPQVYKVRSAPAGGQCAASSARLPLRTDIKAAMRLPLAFTVLLLASAQALADEMSAPDDLSYWADWADGEQKEELPLPLEHFLQRMARRPRPQQFFGLMGKRDAGYGQISHKRHKTDSFVGLMGKRSLNSGSSERSIAQNYERRRK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004297_AF2.pdbhor004297_ESM.pdb

Physical Information

Mass: 108986 Formula: C40H58N12O15
Absent amino acids: CEFKLMNPRTVW Common amino acids: G
pI: 5.29 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -75.56 Boman Index: -1385
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 54.44
Instability Index: -997.78 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  20298575
  • Title:  Neuropeptidomic Analysis of the Embryonic Japanese Quail Diencephalon